Lineage for d1d6ri_ (1d6r I:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701956Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 1701957Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1701958Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 1701975Species Soybean (Glycine max) [TaxId:3847] [57251] (4 PDB entries)
  8. 1701976Domain d1d6ri_: 1d6r I: [44343]
    Other proteins in same PDB: d1d6ra_

Details for d1d6ri_

PDB Entry: 1d6r (more details), 2.3 Å

PDB Description: crystal structure of cancer chemopreventive bowman-birk inhibitor in ternary complex with bovine trypsin at 2.3 a resolution. structural basis of janus-faced serine protease inhibitor specificity
PDB Compounds: (I:) bowman-birk proteinase inhibitor precursor

SCOPe Domain Sequences for d1d6ri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ri_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max) [TaxId: 3847]}
kpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepck

SCOPe Domain Coordinates for d1d6ri_:

Click to download the PDB-style file with coordinates for d1d6ri_.
(The format of our PDB-style files is described here.)

Timeline for d1d6ri_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d6ra_