Lineage for d1pi2a_ (1pi2 A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 890077Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 890078Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)
  6. 890079Protein Bowman-Birk inhibitor, BBI [57249] (10 species)
    duplication: consists of two sequence repeats each having this fold
  7. 890104Species Soybean (Glycine max), PI-II [TaxId:3847] [57250] (1 PDB entry)
  8. 890105Domain d1pi2a_: 1pi2 A: [44342]

Details for d1pi2a_

PDB Entry: 1pi2 (more details), 2.5 Å

PDB Description: reactive sites of an anticarcinogenic bowman-birk proteinase inhibitor are similar to other trypsin inhibitors
PDB Compounds: (A:) bowman-birk inhibitor (pi-II)

SCOP Domain Sequences for d1pi2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pi2a_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max), PI-II [TaxId: 3847]}
yskpccdlcmctrsmppqcscedrinschsdckscmctrsqpgqcrcldtndfcykpcks
r

SCOP Domain Coordinates for d1pi2a_:

Click to download the PDB-style file with coordinates for d1pi2a_.
(The format of our PDB-style files is described here.)

Timeline for d1pi2a_: