Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) |
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein) |
Protein Bowman-Birk inhibitor, BBI [57249] (10 species) duplication: consists of two sequence repeats each having this fold |
Species Soybean (Glycine max), PI-II [TaxId:3847] [57250] (1 PDB entry) |
Domain d1pi2a_: 1pi2 A: [44342] |
PDB Entry: 1pi2 (more details), 2.5 Å
SCOP Domain Sequences for d1pi2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pi2a_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max), PI-II [TaxId: 3847]} yskpccdlcmctrsmppqcscedrinschsdckscmctrsqpgqcrcldtndfcykpcks r
Timeline for d1pi2a_: