![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
![]() | Species Soybean (Glycine max), PI-II [TaxId:3847] [57250] (1 PDB entry) |
![]() | Domain d1pi2a_: 1pi2 A: [44342] |
PDB Entry: 1pi2 (more details), 2.5 Å
SCOPe Domain Sequences for d1pi2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pi2a_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max), PI-II [TaxId: 3847]} yskpccdlcmctrsmppqcscedrinschsdckscmctrsqpgqcrcldtndfcykpcks r
Timeline for d1pi2a_: