Lineage for d1ceja1 (1cej A:1-45)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 89028Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 89029Protein Merozoite surface protein 1 (MSP-1) [57240] (2 species)
  7. 89033Species Plasmodium falciparum [57242] (1 PDB entry)
  8. 89034Domain d1ceja1: 1cej A:1-45 [44336]

Details for d1ceja1

PDB Entry: 1cej (more details)

PDB Description: solution structure of an egf module pair from the plasmodium falciparum merozoite surface protein 1

SCOP Domain Sequences for d1ceja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ceja1 g.3.11.4 (A:1-45) Merozoite surface protein 1 (MSP-1) {Plasmodium falciparum}
nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenp

SCOP Domain Coordinates for d1ceja1:

Click to download the PDB-style file with coordinates for d1ceja1.
(The format of our PDB-style files is described here.)

Timeline for d1ceja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ceja2