Lineage for d1b9wa1 (1b9w A:1-45)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143303Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 143304Protein Merozoite surface protein 1 (MSP-1) [57240] (2 species)
  7. 143305Species Plasmodium cynomolgi [TaxId:5827] [57241] (1 PDB entry)
  8. 143306Domain d1b9wa1: 1b9w A:1-45 [44334]

Details for d1b9wa1

PDB Entry: 1b9w (more details), 1.8 Å

PDB Description: c-terminal merozoite surface protein 1 from plasmodium cynomolgi

SCOP Domain Sequences for d1b9wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9wa1 g.3.11.4 (A:1-45) Merozoite surface protein 1 (MSP-1) {Plasmodium cynomolgi}
mssehrcidtnvpenaacyryldgteewrcllyfkedagkcvpap

SCOP Domain Coordinates for d1b9wa1:

Click to download the PDB-style file with coordinates for d1b9wa1.
(The format of our PDB-style files is described here.)

Timeline for d1b9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b9wa2