Lineage for d1tle__ (1tle -)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342332Family g.3.11.2: Laminin-type module [57233] (1 protein)
  6. 342333Protein Laminin gamma1 chain [57234] (1 species)
  7. 342334Species Mouse (Mus musculus) [TaxId:10090] [57235] (2 PDB entries)
  8. 342338Domain d1tle__: 1tle - [44329]

Details for d1tle__

PDB Entry: 1tle (more details)

PDB Description: le (laminin-type egf-like) module giii4 in solution at ph 3.5 and 290 k, nmr, 14 structures

SCOP Domain Sequences for d1tle__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tle__ g.3.11.2 (-) Laminin gamma1 chain {Mouse (Mus musculus)}
rpcqcndnidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkcka

SCOP Domain Coordinates for d1tle__:

Click to download the PDB-style file with coordinates for d1tle__.
(The format of our PDB-style files is described here.)

Timeline for d1tle__: