SCOP 1.59: Domain d1klo_2: 1klo 66-121

Lineage for d1klo_2 (1klo 66-121)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.2: Laminin-type module [57233] (1 protein)

6. Protein Laminin gamma1 chain [57234] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57235] (2 PDB entries)

8. Domain d1klo_2: 1klo 66-121 [44327]

Details for d1klo_2

PDB Entry: 1klo, 2.1 Å

PDB Description: crystal structure of three consecutive laminin-type epidermal growth factor-like (le) modules of laminin gamma1 chain harboring the nidogen binding site

SCOP Domain Sequences for d1klo_2:

Sequence; same for both SEQRES and ATOM records:

>d1klo_2 g.3.11.2 (66-121) Laminin gamma1 chain {Mouse (Mus musculus)}
cqcndnidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkcka

Timeline for d1klo_2:

• d1klo_2 first appeared (with stable ids) in SCOP 1.55
  
• d1klo_2 appears in SCOP 1.57
  
• d1klo_2 appears in SCOP 1.61
  
• d1klo_2 appears in the current release, SCOPe 2.08, called d1kloa2