Lineage for d1klo_2 (1klo 66-121)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 89014Family g.3.11.2: Laminin-type module [57233] (1 protein)
  6. 89015Protein Laminin gamma1 chain [57234] (1 species)
  7. 89016Species Mouse (Mus musculus) [TaxId:10090] [57235] (2 PDB entries)
  8. 89018Domain d1klo_2: 1klo 66-121 [44327]

Details for d1klo_2

PDB Entry: 1klo (more details), 2.1 Å

PDB Description: crystal structure of three consecutive laminin-type epidermal growth factor-like (le) modules of laminin gamma1 chain harboring the nidogen binding site

SCOP Domain Sequences for d1klo_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klo_2 g.3.11.2 (66-121) Laminin gamma1 chain {Mouse (Mus musculus)}
cqcndnidpnavgncnrltgeclkciyntagfycdrckegffgnplapnpadkcka

SCOP Domain Coordinates for d1klo_2:

Click to download the PDB-style file with coordinates for d1klo_2.
(The format of our PDB-style files is described here.)

Timeline for d1klo_2: