Lineage for d1klo_1 (1klo 11-65)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342332Family g.3.11.2: Laminin-type module [57233] (1 protein)
  6. 342333Protein Laminin gamma1 chain [57234] (1 species)
  7. 342334Species Mouse (Mus musculus) [TaxId:10090] [57235] (2 PDB entries)
  8. 342335Domain d1klo_1: 1klo 11-65 [44326]

Details for d1klo_1

PDB Entry: 1klo (more details), 2.1 Å

PDB Description: crystal structure of three consecutive laminin-type epidermal growth factor-like (le) modules of laminin gamma1 chain harboring the nidogen binding site

SCOP Domain Sequences for d1klo_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klo_1 g.3.11.2 (11-65) Laminin gamma1 chain {Mouse (Mus musculus)}
cpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrp

SCOP Domain Coordinates for d1klo_1:

Click to download the PDB-style file with coordinates for d1klo_1.
(The format of our PDB-style files is described here.)

Timeline for d1klo_1: