Lineage for d1kloa1 (1klo A:11-65)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031753Family g.3.11.2: Laminin-type module [57233] (1 protein)
    automatically mapped to Pfam PF00053
  6. 3031754Protein Laminin gamma1 chain [57234] (1 species)
  7. 3031755Species Mouse (Mus musculus) [TaxId:10090] [57235] (3 PDB entries)
  8. 3031756Domain d1kloa1: 1klo A:11-65 [44326]

Details for d1kloa1

PDB Entry: 1klo (more details), 2.1 Å

PDB Description: crystal structure of three consecutive laminin-type epidermal growth factor-like (le) modules of laminin gamma1 chain harboring the nidogen binding site
PDB Compounds: (A:) laminin

SCOPe Domain Sequences for d1kloa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}
cpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrp

SCOPe Domain Coordinates for d1kloa1:

Click to download the PDB-style file with coordinates for d1kloa1.
(The format of our PDB-style files is described here.)

Timeline for d1kloa1: