![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Plasminogen activator (tissue-type), t-PA [57231] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57232] (1 PDB entry) |
![]() | Domain d1tpga1: 1tpg A:51-91 [44325] Other proteins in same PDB: d1tpga2 |
PDB Entry: 1tpg (more details)
SCOPe Domain Sequences for d1tpga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} cseprcfnggtcqqalyfsdfvcqcpegfagksceidtrat
Timeline for d1tpga1: