Lineage for d1tpg_1 (1tpg 51-91)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427874Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 427875Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 428050Protein Plasminogen activator (tissue-type), t-PA [57231] (1 species)
  7. 428051Species Human (Homo sapiens) [TaxId:9606] [57232] (1 PDB entry)
  8. 428052Domain d1tpg_1: 1tpg 51-91 [44325]
    Other proteins in same PDB: d1tpg_2
    mutant

Details for d1tpg_1

PDB Entry: 1tpg (more details)

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)

SCOP Domain Sequences for d1tpg_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpg_1 g.3.11.1 (51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens)}
cseprcfnggtcqqalyfsdfvcqcpegfagksceidtrat

SCOP Domain Coordinates for d1tpg_1:

Click to download the PDB-style file with coordinates for d1tpg_1.
(The format of our PDB-style files is described here.)

Timeline for d1tpg_1:

428052
d1tpg_1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1tpg_2