Lineage for d1apqa_ (1apq A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031288Protein Complement protease C1R [57229] (1 species)
  7. 3031289Species Human (Homo sapiens) [TaxId:9606] [57230] (1 PDB entry)
  8. 3031290Domain d1apqa_: 1apq A: [44324]

Details for d1apqa_

PDB Entry: 1apq (more details)

PDB Description: structure of the egf-like module of human c1r, nmr, 19 structures
PDB Compounds: (A:) complement protease c1r

SCOPe Domain Sequences for d1apqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}
avdldecasrsksgeedpqpqcqhlchnyvggyfcscrpgyelqedrhscqae

SCOPe Domain Coordinates for d1apqa_:

Click to download the PDB-style file with coordinates for d1apqa_.
(The format of our PDB-style files is described here.)

Timeline for d1apqa_: