Lineage for d1dqba1 (1dqb A:1-44)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961633Protein Thrombomodulin, different EGF-like domains [57225] (1 species)
  7. 1961634Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries)
  8. 1961651Domain d1dqba1: 1dqb A:1-44 [44318]
    complexed with nag

Details for d1dqba1

PDB Entry: 1dqb (more details)

PDB Description: nmr structure of thrombomodulin egf(4-5)
PDB Compounds: (A:) thrombomodulin

SCOPe Domain Sequences for d1dqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqba1 g.3.11.1 (A:1-44) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
hmepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcq

SCOPe Domain Coordinates for d1dqba1:

Click to download the PDB-style file with coordinates for d1dqba1.
(The format of our PDB-style files is described here.)

Timeline for d1dqba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqba2