Lineage for d2adxa_ (2adx A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701720Protein Thrombomodulin, different EGF-like domains [57225] (1 species)
  7. 1701721Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries)
  8. 1701737Domain d2adxa_: 2adx A: [44317]

Details for d2adxa_

PDB Entry: 2adx (more details)

PDB Description: fifth egf-like domain of thrombomodulin (tmegf5), nmr, minimized average structure
PDB Compounds: (A:) thrombomodulin

SCOPe Domain Sequences for d2adxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2adxa_ g.3.11.1 (A:) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
qmfcnqtacpadcdpntqascecpegyilddgfictdide

SCOPe Domain Coordinates for d2adxa_:

Click to download the PDB-style file with coordinates for d2adxa_.
(The format of our PDB-style files is described here.)

Timeline for d2adxa_: