Class g: Small proteins [56992] (72 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (21 proteins) |
Protein Thrombomodulin, different EGF-like domains [57225] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries) |
Domain d1dx5l1: 1dx5 L:345-387 [44311] Other proteins in same PDB: d1dx5.1, d1dx5.2, d1dx5.3, d1dx5.4 |
PDB Entry: 1dx5 (more details), 2.3 Å
SCOP Domain Sequences for d1dx5l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dx5l1 g.3.11.1 (L:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens)} vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcq
Timeline for d1dx5l1: