SCOPe 2.07: Domain d1hrea_: 1hre A:

Lineage for d1hrea_ (1hre A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Heregulin-alpha, EGF-like domain [57223] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries)

8. Domain d1hrea_: 1hre A: [44300]

Details for d1hrea_

PDB Entry: 1hre

PDB Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4

PDB Compounds: (A:) heregulin alpha

SCOPe Domain Sequences for d1hrea_:

Sequence; same for both SEQRES and ATOM records:

>d1hrea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}
gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
aeelyqk

Timeline for d1hrea_:

• d1hrea_ first appeared (with stable ids) in SCOP 1.55, called d1hre__
  
• d1hrea_ appears in SCOPe 2.06
  
• d1hrea_ appears in the current release, SCOPe 2.08