Lineage for d1hre__ (1hre -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40041Protein Heregulin-alpha, EGF-like domain [57223] (1 species)
  7. 40042Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries)
  8. 40045Domain d1hre__: 1hre - [44300]

Details for d1hre__

PDB Entry: 1hre (more details)

PDB Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4

SCOP Domain Sequences for d1hre__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hre__ g.3.11.1 (-) Heregulin-alpha, EGF-like domain {Human (Homo sapiens)}
gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
aeelyqk

SCOP Domain Coordinates for d1hre__:

Click to download the PDB-style file with coordinates for d1hre__.
(The format of our PDB-style files is described here.)

Timeline for d1hre__: