Lineage for d1urk_1 (1urk 6-49)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427874Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 427875Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 428053Protein Plasminogen activator (urokinase-type) [57221] (1 species)
  7. 428054Species Human (Homo sapiens) [TaxId:9606] [57222] (1 PDB entry)
  8. 428055Domain d1urk_1: 1urk 6-49 [44297]
    Other proteins in same PDB: d1urk_2
    complexed with fuc

Details for d1urk_1

PDB Entry: 1urk (more details)

PDB Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator

SCOP Domain Sequences for d1urk_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urk_1 g.3.11.1 (6-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens)}
qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOP Domain Coordinates for d1urk_1:

Click to download the PDB-style file with coordinates for d1urk_1.
(The format of our PDB-style files is described here.)

Timeline for d1urk_1:

428055
d1urk_1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1urk_2