Class g: Small proteins [56992] (72 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (21 proteins) |
Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57222] (1 PDB entry) |
Domain d1urk_1: 1urk 6-49 [44297] Other proteins in same PDB: d1urk_2 complexed with fuc |
PDB Entry: 1urk (more details)
SCOP Domain Sequences for d1urk_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urk_1 g.3.11.1 (6-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens)} qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d1urk_1: