Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Heparin-binding epidermal growth factor, HBEGF [57219] (1 species) extracellular domain |
Species Human (Homo sapiens) [TaxId:9606] [57220] (1 PDB entry) |
Domain d1xdtr_: 1xdt R: [44296] Other proteins in same PDB: d1xdtt1, d1xdtt2, d1xdtt3 |
PDB Entry: 1xdt (more details), 2.65 Å
SCOPe Domain Sequences for d1xdtr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} pclrkykdfcihgeckyvkelrapscichpgyhgerchgls
Timeline for d1xdtr_: