Lineage for d1yufa_ (1yuf A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636404Protein Transforming growth factor alpha [57217] (1 species)
  7. 2636405Species Human (Homo sapiens) [TaxId:9606] [57218] (7 PDB entries)
  8. 2636413Domain d1yufa_: 1yuf A: [44295]

Details for d1yufa_

PDB Entry: 1yuf (more details)

PDB Description: type alpha transforming growth factor, nmr, 16 models without energy minimization
PDB Compounds: (A:) transforming growth factor alpha

SCOPe Domain Sequences for d1yufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yufa_ g.3.11.1 (A:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOPe Domain Coordinates for d1yufa_:

Click to download the PDB-style file with coordinates for d1yufa_.
(The format of our PDB-style files is described here.)

Timeline for d1yufa_: