Lineage for d1yuf__ (1yuf -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40116Protein Transforming growth factor alpha [57217] (1 species)
  7. 40117Species Human (Homo sapiens) [TaxId:9606] [57218] (5 PDB entries)
  8. 40121Domain d1yuf__: 1yuf - [44295]

Details for d1yuf__

PDB Entry: 1yuf (more details)

PDB Description: type alpha transforming growth factor, nmr, 16 models without energy minimization

SCOP Domain Sequences for d1yuf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuf__ g.3.11.1 (-) Transforming growth factor alpha {Human (Homo sapiens)}
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOP Domain Coordinates for d1yuf__:

Click to download the PDB-style file with coordinates for d1yuf__.
(The format of our PDB-style files is described here.)

Timeline for d1yuf__: