Lineage for d4tgf__ (4tgf -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 89007Protein Transforming growth factor alpha [57217] (1 species)
  7. 89008Species Human (Homo sapiens) [TaxId:9606] [57218] (5 PDB entries)
  8. 89013Domain d4tgf__: 4tgf - [44294]

Details for d4tgf__

PDB Entry: 4tgf (more details)

PDB Description: solution structures of human transforming growth factor alpha derived from 1*h nmr data

SCOP Domain Sequences for d4tgf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tgf__ g.3.11.1 (-) Transforming growth factor alpha {Human (Homo sapiens)}
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOP Domain Coordinates for d4tgf__:

Click to download the PDB-style file with coordinates for d4tgf__.
(The format of our PDB-style files is described here.)

Timeline for d4tgf__: