Lineage for d4tgfa_ (4tgf A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031654Protein Transforming growth factor alpha [57217] (1 species)
  7. 3031655Species Human (Homo sapiens) [TaxId:9606] [57218] (7 PDB entries)
  8. 3031661Domain d4tgfa_: 4tgf A: [44294]

Details for d4tgfa_

PDB Entry: 4tgf (more details)

PDB Description: solution structures of human transforming growth factor alpha derived from 1*h nmr data
PDB Compounds: (A:) des-val-1,val-2,transforming growth factor, alpha

SCOPe Domain Sequences for d4tgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tgfa_ g.3.11.1 (A:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOPe Domain Coordinates for d4tgfa_:

Click to download the PDB-style file with coordinates for d4tgfa_.
(The format of our PDB-style files is described here.)

Timeline for d4tgfa_: