Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Transforming growth factor alpha [57217] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57218] (6 PDB entries) |
Domain d2tgfa_: 2tgf A: [44291] |
PDB Entry: 2tgf (more details)
SCOP Domain Sequences for d2tgfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tgfa_ g.3.11.1 (A:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
Timeline for d2tgfa_: