Lineage for d2tgf__ (2tgf -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 622118Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 622119Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 622392Protein Transforming growth factor alpha [57217] (1 species)
  7. 622393Species Human (Homo sapiens) [TaxId:9606] [57218] (6 PDB entries)
  8. 622399Domain d2tgf__: 2tgf - [44291]

Details for d2tgf__

PDB Entry: 2tgf (more details)

PDB Description: the solution structure of human transforming growth factor alpha

SCOP Domain Sequences for d2tgf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tgf__ g.3.11.1 (-) Transforming growth factor alpha {Human (Homo sapiens)}
vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla

SCOP Domain Coordinates for d2tgf__:

Click to download the PDB-style file with coordinates for d2tgf__.
(The format of our PDB-style files is described here.)

Timeline for d2tgf__: