Class g: Small proteins [56992] (79 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Transforming growth factor alpha [57217] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57218] (6 PDB entries) |
Domain d2tgf__: 2tgf - [44291] |
PDB Entry: 2tgf (more details)
SCOP Domain Sequences for d2tgf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tgf__ g.3.11.1 (-) Transforming growth factor alpha {Human (Homo sapiens)} vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
Timeline for d2tgf__: