Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Epidermal growth factor, EGF [57215] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries) |
Domain d1egfa_: 1egf A: [44290] |
PDB Entry: 1egf (more details)
SCOPe Domain Sequences for d1egfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr
Timeline for d1egfa_: