Lineage for d1egfa_ (1egf A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258260Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 2258269Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries)
  8. 2258271Domain d1egfa_: 1egf A: [44290]

Details for d1egfa_

PDB Entry: 1egf (more details)

PDB Description: solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints
PDB Compounds: (A:) epidermal growth factor

SCOPe Domain Sequences for d1egfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr

SCOPe Domain Coordinates for d1egfa_:

Click to download the PDB-style file with coordinates for d1egfa_.
(The format of our PDB-style files is described here.)

Timeline for d1egfa_: