Lineage for d1epia_ (1epi A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636061Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 2636070Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries)
  8. 2636077Domain d1epia_: 1epi A: [44288]

Details for d1epia_

PDB Entry: 1epi (more details)

PDB Description: three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological ph solutions
PDB Compounds: (A:) epidermal growth factor

SCOPe Domain Sequences for d1epia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epia_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr

SCOPe Domain Coordinates for d1epia_:

Click to download the PDB-style file with coordinates for d1epia_.
(The format of our PDB-style files is described here.)

Timeline for d1epia_: