Lineage for d1epg__ (1epg -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88865Protein Epidermal growth factor, EGF [57215] (1 species)
  7. 88866Species Mouse (Mus musculus) [TaxId:10090] [57216] (7 PDB entries)
  8. 88869Domain d1epg__: 1epg - [44286]

Details for d1epg__

PDB Entry: 1epg (more details)

PDB Description: three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological ph solutions

SCOP Domain Sequences for d1epg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epg__ g.3.11.1 (-) Epidermal growth factor, EGF {Mouse (Mus musculus)}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr

SCOP Domain Coordinates for d1epg__:

Click to download the PDB-style file with coordinates for d1epg__.
(The format of our PDB-style files is described here.)

Timeline for d1epg__: