| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Epidermal growth factor, EGF [57215] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries) |
| Domain d3egfa_: 3egf A: [44285] |
PDB Entry: 3egf (more details)
SCOPe Domain Sequences for d3egfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr
Timeline for d3egfa_: