Lineage for d1fsba_ (1fsb A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701618Protein P-selectin, EGF-domain [57213] (1 species)
  7. 1701619Species Human (Homo sapiens) [TaxId:9606] [57214] (1 PDB entry)
  8. 1701620Domain d1fsba_: 1fsb A: [44283]

Details for d1fsba_

PDB Entry: 1fsb (more details)

PDB Description: structure of the egf domain of p-selectin, nmr, 19 structures
PDB Compounds: (A:) p-selectin

SCOPe Domain Sequences for d1fsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsba_ g.3.11.1 (A:) P-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvre

SCOPe Domain Coordinates for d1fsba_:

Click to download the PDB-style file with coordinates for d1fsba_.
(The format of our PDB-style files is described here.)

Timeline for d1fsba_: