SCOPe 2.08: Domain d5coxc2: 5cox C:33-73

Lineage for d5coxc2 (5cox C:33-73)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)

8. Domain d5coxc2: 5cox C:33-73 [44281]
   Other proteins in same PDB: d5coxa1, d5coxb1, d5coxc1, d5coxd1
   complexed with hem, nag

Details for d5coxc2

PDB Entry: 5cox, 3 Å

PDB Description: uninhibited mouse cyclooxygenase-2 (prostaglandin synthase-2)

PDB Compounds: (C:) cyclooxygenase-2

SCOPe Domain Sequences for d5coxc2:

Sequence; same for both SEQRES and ATOM records:

>d5coxc2 g.3.11.1 (C:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d5coxc2:

• d5coxc2 first appeared (with stable ids) in SCOP 1.55
  
• d5coxc2 appears in SCOPe 2.07