Lineage for d5coxb2 (5cox B:33-73)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40056Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 40057Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)
  8. 40079Domain d5coxb2: 5cox B:33-73 [44280]
    Other proteins in same PDB: d5coxa1, d5coxb1, d5coxc1, d5coxd1

Details for d5coxb2

PDB Entry: 5cox (more details), 3 Å

PDB Description: uninhibited mouse cyclooxygenase-2 (prostaglandin synthase-2)

SCOP Domain Sequences for d5coxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5coxb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d5coxb2:

Click to download the PDB-style file with coordinates for d5coxb2.
(The format of our PDB-style files is described here.)

Timeline for d5coxb2:

40079
d5coxb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5coxb1