Lineage for d1ddxd2 (1ddx D:3033-3073)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88938Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 88939Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)
  8. 88959Domain d1ddxd2: 1ddx D:3033-3073 [44278]
    Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1

Details for d1ddxd2

PDB Entry: 1ddx (more details), 3 Å

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure

SCOP Domain Sequences for d1ddxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddxd2 g.3.11.1 (D:3033-3073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d1ddxd2:

Click to download the PDB-style file with coordinates for d1ddxd2.
(The format of our PDB-style files is described here.)

Timeline for d1ddxd2: