Lineage for d1ddxc2 (1ddx C:2033-2073)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 protein domains)
  6. 2583007Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 2583008Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)
  8. 2583044Domain d1ddxc2: 1ddx C:2033-2073 [44277]
    Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1
    complexed with bog, nag, pgx

Details for d1ddxc2

PDB Entry: 1ddx (more details), 3 Å

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure
PDB Compounds: (C:) protein (prostaglandin h2 synthase-2)

SCOPe Domain Sequences for d1ddxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddxc2 g.3.11.1 (C:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d1ddxc2:

Click to download the PDB-style file with coordinates for d1ddxc2.
(The format of our PDB-style files is described here.)

Timeline for d1ddxc2: