SCOP 1.55: Domain d1ddxa2: 1ddx A:33-73

Lineage for d1ddxa2 (1ddx A:33-73)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (4 families)

5. Family g.3.11.1: EGF-type module [57197] (16 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)

8. Domain d1ddxa2: 1ddx A:33-73 [44275]
   Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1

Details for d1ddxa2

PDB Entry: 1ddx, 3 Å

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure

SCOP Domain Sequences for d1ddxa2:

Sequence; same for both SEQRES and ATOM records:

>d1ddxa2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1ddxa2:

• d1ddxa2 appears in SCOP 1.57
  
• d1ddxa2 appears in the current release, SCOPe 2.08