Lineage for d6coxb2 (6cox B:33-73)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889912Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 889913Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries)
  8. 889925Domain d6coxb2: 6cox B:33-73 [44274]
    Other proteins in same PDB: d6coxa1, d6coxb1
    complexed with hem, nag, s58

Details for d6coxb2

PDB Entry: 6cox (more details), 2.8 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a selective inhibitor, sc-558 in i222 space group
PDB Compounds: (B:) cyclooxygenase-2

SCOP Domain Sequences for d6coxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6coxb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d6coxb2:

Click to download the PDB-style file with coordinates for d6coxb2.
(The format of our PDB-style files is described here.)

Timeline for d6coxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6coxb1