Lineage for d6coxa2 (6cox A:33-73)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143211Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 143212Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)
  8. 143227Domain d6coxa2: 6cox A:33-73 [44273]
    Other proteins in same PDB: d6coxa1, d6coxb1

Details for d6coxa2

PDB Entry: 6cox (more details), 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a selective inhibitor, sc-558 in i222 space group

SCOP Domain Sequences for d6coxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6coxa2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d6coxa2:

Click to download the PDB-style file with coordinates for d6coxa2.
(The format of our PDB-style files is described here.)

Timeline for d6coxa2:

143227
d6coxa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6coxa1