Lineage for d4coxd2 (4cox D:33-73)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701638Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 1701639Species Mouse (Mus musculus) [TaxId:10090] [57212] (11 PDB entries)
  8. 1701661Domain d4coxd2: 4cox D:33-73 [44268]
    Other proteins in same PDB: d4coxa1, d4coxb1, d4coxc1, d4coxd1
    complexed with hem, imn, nag

Details for d4coxd2

PDB Entry: 4cox (more details), 2.9 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non- selective inhibitor, indomethacin
PDB Compounds: (D:) cyclooxygenase-2

SCOPe Domain Sequences for d4coxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4coxd2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d4coxd2:

Click to download the PDB-style file with coordinates for d4coxd2.
(The format of our PDB-style files is described here.)

Timeline for d4coxd2: