SCOPe 2.04: Domain d1cx2c2: 1cx2 C:33-73

Lineage for d1cx2c2 (1cx2 C:33-73)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (11 PDB entries)

8. Domain d1cx2c2: 1cx2 C:33-73 [44263]
   Other proteins in same PDB: d1cx2a1, d1cx2b1, d1cx2c1, d1cx2d1
   complexed with hem, nag, s58

Details for d1cx2c2

PDB Entry: 1cx2, 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a selective inhibitor, sc-558

PDB Compounds: (C:) cyclooxygenase-2

SCOPe Domain Sequences for d1cx2c2:

Sequence; same for both SEQRES and ATOM records:

>d1cx2c2 g.3.11.1 (C:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1cx2c2:

• d1cx2c2 first appeared (with stable ids) in SCOP 1.55
  
• d1cx2c2 appears in SCOPe 2.03
  
• d1cx2c2 appears in SCOPe 2.05
  
• d1cx2c2 appears in the current release, SCOPe 2.08