| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
| Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries) |
| Domain d1cx2c2: 1cx2 C:33-73 [44263] Other proteins in same PDB: d1cx2a1, d1cx2b1, d1cx2c1, d1cx2d1 |
PDB Entry: 1cx2 (more details), 3 Å
SCOP Domain Sequences for d1cx2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx2c2 g.3.11.1 (C:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d1cx2c2: