Lineage for d1cx2c2 (1cx2 C:33-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031550Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 3031551Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)
  8. 3031584Domain d1cx2c2: 1cx2 C:33-73 [44263]
    Other proteins in same PDB: d1cx2a1, d1cx2b1, d1cx2c1, d1cx2d1
    complexed with hem, nag, s58

Details for d1cx2c2

PDB Entry: 1cx2 (more details), 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a selective inhibitor, sc-558
PDB Compounds: (C:) cyclooxygenase-2

SCOPe Domain Sequences for d1cx2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx2c2 g.3.11.1 (C:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d1cx2c2:

Click to download the PDB-style file with coordinates for d1cx2c2.
(The format of our PDB-style files is described here.)

Timeline for d1cx2c2: