Lineage for d1cx2a2 (1cx2 A:33-73)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (5 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries) 
Domain d1cx2a2: 1cx2 A:33-73 [44261]
Other proteins in same PDB: d1cx2a1, d1cx2b1, d1cx2c1, d1cx2d1
Details for d1cx2a2
PDB Entry: 1cx2 (more details), 3 Å
PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a selective inhibitor, sc-558
SCOP Domain Sequences for d1cx2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx2a2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
SCOP Domain Coordinates for d1cx2a2:
Click to download the PDB-style file with coordinates for d1cx2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cx2a2:
View in 3D
