Lineage for d1cvub2 (1cvu B:2033-2073)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636300Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 2636301Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)
  8. 2636307Domain d1cvub2: 1cvu B:2033-2073 [44260]
    Other proteins in same PDB: d1cvua1, d1cvub1
    complexed with acd, bog, nag

Details for d1cvub2

PDB Entry: 1cvu (more details), 2.4 Å

PDB Description: crystal structure of arachidonic acid bound to the cyclooxygenase active site of cox-2
PDB Compounds: (B:) prostaglandin h2 synthase-2

SCOPe Domain Sequences for d1cvub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvub2 g.3.11.1 (B:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d1cvub2:

Click to download the PDB-style file with coordinates for d1cvub2.
(The format of our PDB-style files is described here.)

Timeline for d1cvub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cvub1