| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
| Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries) |
| Domain d1cvub2: 1cvu B:2033-2073 [44260] Other proteins in same PDB: d1cvua1, d1cvub1 complexed with acd, bog, man, nag; mutant |
PDB Entry: 1cvu (more details), 2.4 Å
SCOP Domain Sequences for d1cvub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvub2 g.3.11.1 (B:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d1cvub2: