SCOP 1.75: Domain d1cvub2: 1cvu B:2033-2073

Lineage for d1cvub2 (1cvu B:2033-2073)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries)

8. Domain d1cvub2: 1cvu B:2033-2073 [44260]
   Other proteins in same PDB: d1cvua1, d1cvub1
   complexed with acd, bog, man, nag; mutant

Details for d1cvub2

PDB Entry: 1cvu, 2.4 Å

PDB Description: crystal structure of arachidonic acid bound to the cyclooxygenase active site of cox-2

PDB Compounds: (B:) prostaglandin h2 synthase-2

SCOP Domain Sequences for d1cvub2:

Sequence; same for both SEQRES and ATOM records:

>d1cvub2 g.3.11.1 (B:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1cvub2:

• d1cvub2 first appeared (with stable ids) in SCOP 1.55
  
• d1cvub2 appears in SCOP 1.73
  
• d1cvub2 appears in SCOPe 2.01
  
• d1cvub2 appears in the current release, SCOPe 2.08