SCOPe 2.07: Domain d1cvua2: 1cvu A:33-73

Lineage for d1cvua2 (1cvu A:33-73)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)

8. Domain d1cvua2: 1cvu A:33-73 [44259]
   Other proteins in same PDB: d1cvua1, d1cvub1
   complexed with acd, bog, nag

Details for d1cvua2

PDB Entry: 1cvu, 2.4 Å

PDB Description: crystal structure of arachidonic acid bound to the cyclooxygenase active site of cox-2

PDB Compounds: (A:) prostaglandin h2 synthase-2

SCOPe Domain Sequences for d1cvua2:

Sequence; same for both SEQRES and ATOM records:

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1cvua2:

• d1cvua2 first appeared (with stable ids) in SCOP 1.55
  
• d1cvua2 appears in SCOPe 2.06
  
• d1cvua2 appears in the current release, SCOPe 2.08