Lineage for d1cvua2 (1cvu A:33-73)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (5 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries) 
Domain d1cvua2: 1cvu A:33-73 [44259]
Other proteins in same PDB: d1cvua1, d1cvub1
Details for d1cvua2
PDB Entry: 1cvu (more details), 2.4 Å
PDB Description: crystal structure of arachidonic acid bound to the cyclooxygenase active site of cox-2
SCOP Domain Sequences for d1cvua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
SCOP Domain Coordinates for d1cvua2:
Click to download the PDB-style file with coordinates for d1cvua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cvua2:
View in 3D
