Lineage for d1prha2 (1prh A:33-73)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889912Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 889942Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries)
    Uniprot P05979 32-584
  8. 889969Domain d1prha2: 1prh A:33-73 [44253]
    Other proteins in same PDB: d1prha1, d1prhb1

Details for d1prha2

PDB Entry: 1prh (more details), 3.5 Å

PDB Description: the x-ray crystal structure of the membrane protein prostaglandin h2 synthase-1
PDB Compounds: (A:) prostaglandin h2 synthase-1

SCOP Domain Sequences for d1prha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prha2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOP Domain Coordinates for d1prha2:

Click to download the PDB-style file with coordinates for d1prha2.
(The format of our PDB-style files is described here.)

Timeline for d1prha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1prha1