Lineage for d1ebva2 (1ebv A:33-73)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families) 
Family g.3.11.1: EGF-type module [57197] (23 proteins) 
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
the rest of protein is heme-linked peroxidase, all-alpha fold
Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries)
Uniprot P05979 32-584
Domain d1ebva2: 1ebv A:33-73 [44252]
Other proteins in same PDB: d1ebva1
complexed with hem, nag, scl
Details for d1ebva2
PDB Entry: 1ebv (more details), 3.2 Å
PDB Description: ovine pghs-1 complexed with salicyl hydroxamic acid
PDB Compounds: (A:) prostaglandin h2 synthaseSCOPe Domain Sequences for d1ebva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebva2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
SCOPe Domain Coordinates for d1ebva2:
Click to download the PDB-style file with coordinates for d1ebva2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ebva2:
View in 3D
