Lineage for d1ebva2 (1ebv A:33-73)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (5 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) 
Species Sheep (Ovis aries) [TaxId:9940] [57211] (13 PDB entries) 
Domain d1ebva2: 1ebv A:33-73 [44252]
Other proteins in same PDB: d1ebva1
Details for d1ebva2
PDB Entry: 1ebv (more details), 3.2 Å
PDB Description: ovine pghs-1 complexed with salicyl hydroxamic acid
SCOP Domain Sequences for d1ebva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebva2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
SCOP Domain Coordinates for d1ebva2:
Click to download the PDB-style file with coordinates for d1ebva2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ebva2:
View in 3D
